PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G212600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 327aa    MW: 35189.8 Da    PI: 11.5802
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G212600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.2e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd+ lv +v+++G+g+W++++   g+ R+ k+c++rw +yl
  Sevir.2G212600.1.p 14 KGPWTPEEDLMLVSYVQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding50.74.2e-1667112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T +E++l++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Sevir.2G212600.1.p  67 RGNFTDQEEKLIIHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.935965IPR017930Myb domain
SuperFamilySSF466891.35E-3011108IPR009057Homeodomain-like
SMARTSM007177.5E-141363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001673.46E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129420.59266116IPR017930Myb domain
SMARTSM007172.5E-1666114IPR001005SANT/Myb domain
PfamPF002494.2E-1567112IPR001005SANT/Myb domain
CDDcd001672.69E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLMLVSYVQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIIH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMQ  120
AGGEASGRPQ GAVGAAAADR HPHSAAGAAR RALAGALGAA SEGGAPTDAS GVRDVRVQRR  180
EHRAAAGGVA APGRRQRGQG AGGVGVDVHN GDDAAAAAVL RRGRGFRVGE PQRRRGREHG  240
RAYPGVLDGD QQDGKQRRGG RRRRAGVLDA GELASRRRHG PQRGGAHGRC GATRGPQTIS  300
CGILVKFSRI QVKQFDGFFK SYLTKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251211625128MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794331e-156HF679433.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB27 protein.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.12e-81myb domain protein 94